GIP

⚠️ Structural Separation Notice

The Ageless Pep Academy is a clinical education property independent from any commerce operation. Any references in this profile to Ageless Peps product SKUs, pricing, or the agelesspeps.com domain are for completeness and transparency; they are not endorsements and do not form part of the clinical education content. Clinicians are responsible for independent verification of any product sourcing decision. The Academy's Medical Director provides editorial oversight only and does not endorse commercial products.

Endogenous 42-amino acid incretin hormone; glucose-dependent insulinotropic peptide responsible for 60-80% of the incretin effect. Template for the GIP component of tirzepatide and retatrutide.

Quick Facts

Property	Value
Also Known As	Glucose-dependent Insulinotropic Peptide, Gastric Inhibitory Polypeptide (historical), GIP(1-42)
Category	Metabolic / Endogenous reference peptide
Sequence	42 amino acids (YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ)
Molecular Weight	~4984 Da
Molecular Formula	C₂₂₅H₃₄₈N₆₄O₆₈S₂
PubChem CID	16132418
Administration	Not used therapeutically (rapidly degraded by DPP-4)
Typical Dose Range	Not applicable — endogenous reference
Half-Life	~5-7 minutes (DPP-4 cleaves Ala2 within minutes)
Storage	Research-grade: lyophilized, -20 C
FDA Status	Not a drug product; endogenous hormone. GIPR is targeted by FDA-approved tirzepatide (2022)
WADA Status	Not listed

Mechanism of Action

GIP (glucose-dependent insulinotropic peptide) is a 42-amino acid incretin hormone secreted from enteroendocrine K cells in the duodenum and proximal jejunum in response to nutrient ingestion (primarily glucose and fat). It is the first incretin hormone ever identified (1970s) and accounts for approximately 60-80% of the total incretin effect — the phenomenon whereby oral glucose produces a greater insulin response than equivalent IV glucose (PMID-39951489).

GIP signals through the GIP receptor (GIPR), a class B G-protein coupled receptor expressed on pancreatic beta cells, alpha cells, adipocytes, osteoblasts, and several brain regions. GIPR couples primarily to Gs, activating adenylyl cyclase and increasing cAMP, which enhances glucose-dependent insulin secretion through PKA and EPAC2-mediated pathways (PMID-24843641).

Key physiological actions:

Glucose-dependent insulinotropism — GIP augments insulin secretion ONLY when blood glucose is elevated (safety mechanism against hypoglycemia). This is the dominant incretin effect.
Adipose tissue effects — GIP promotes lipid storage in adipocytes (lipogenic effect), enhances adipose blood flow and triglyceride uptake. This action is metabolic state-dependent.
Bone formation — GIP stimulates osteoblast activity via GIPR, coupling nutrient absorption to bone anabolism. Postprandial GIP contributes to meal-related bone turnover marker suppression.
Glucagon modulation — GIP stimulates glucagon secretion at low glucose (protective against hypoglycemia) but effects are blunted at high glucose.
Neuroprotection — GIPR expression in brain regions suggests neurotrophic roles; GIP analogs show neuroprotective effects in preclinical Alzheimer's models.

The GIP paradox in T2D: The incretin effect is impaired in type 2 diabetes, primarily due to reduced beta cell responsiveness to GIP (while GLP-1 retains partial activity). This led to the historical view that GIPR agonism was not a viable therapeutic strategy. However, tirzepatide's clinical success demonstrated that pharmacological doses of GIPR agonism, combined with GLP-1R agonism, produce superior outcomes, likely by overcoming GIP resistance through supraphysiological receptor activation.

The GIPR agonism vs antagonism paradox: Remarkably, both GIPR agonism (tirzepatide) and GIPR antagonism reduce body weight in preclinical models. The mechanism remains debated — one hypothesis is that sustained GIPR agonism causes receptor desensitization (functional antagonism at the adipocyte level) while maintaining beneficial beta cell effects (PMID-39951489).

Key Research Areas

Incretin physiology — GIP as the dominant incretin hormone, responsible for majority of postprandial insulin augmentation (PMID-39951489)
Dual and triple agonist therapeutics — Understanding GIP explains why tirzepatide (GIP/GLP-1) and retatrutide (GIP/GLP-1/glucagon) surpass GLP-1-only agents (PMID-24843641)
GIP resistance in T2D — Why the incretin effect fails in diabetes and how pharmacological doses overcome it
Adipose biology — GIP's role in lipid storage, adipogenesis, and the agonism/antagonism paradox
Bone metabolism — GIPR-mediated coupling of nutrition to bone formation

Evidence Level Summary

Evidence Type	Count	Notes
Human RCTs	Many	For tirzepatide (SURPASS/SURMOUNT trials targeting GIPR)
Systematic reviews	Several	Incretin biology, tirzepatide efficacy
Human observational	Many	Incretin effect studies, GIP levels in T2D
Animal in vivo	Extensive	GIPR knockout mice, adipose-specific studies
In vitro	Extensive	Receptor signaling, beta cell biology

Clinical Applications

Weight Management — GIP pathway targeted by tirzepatide, retatrutide
Type 2 Diabetes — Incretin-based therapy via dual agonists
Metabolic Syndrome — Metabolic benefits beyond glucose control

Protocols Using This Peptide

GIP itself is not used in protocols. Its receptor (GIPR) is targeted by:

Weight Loss Protocol — Via tirzepatide (GIP/GLP-1 dual agonist)

Ageless Peps Products

GIP is an endogenous hormone and is NOT sold as a product. Understanding GIP biology is relevant to:

Products containing GLP-1 pathway components (Weight Loss FAST Melts)
Understanding the competitive landscape (tirzepatide, retatrutide)

Dosing Reference

Endogenous Levels

Measurement	Value	Context
Fasting plasma	~10-20 pmol/L	Healthy adults
Postprandial peak	~200-500 pmol/L	15-30 min after meal (10-25x fasting)
DPP-4 degradation	~5-7 min half-life	GIP(1-42) → GIP(3-42) (inactive)
T2D levels	Normal or elevated	But beta cell response is blunted

Cycling

Not applicable — endogenous hormone with meal-stimulated secretion.

Contraindications & Safety

Contraindications: Not applicable (endogenous hormone)
Pathological significance: GIP resistance in T2D; potential role in adipose lipid storage (obesity context)
Drug interactions: DPP-4 inhibitors (sitagliptin etc.) raise GIP levels by preventing degradation
Pregnancy/nursing: Endogenous; normal physiological function
Special populations: Post-bariatric surgery patients have reduced GIP secretion (especially after Roux-en-Y)

Synergistic Combinations

Understanding GIP's complementary mechanism explains therapeutic combinations:

GIP pathway + GLP-1 pathway → Tirzepatide (dual agonist; SURPASS/SURMOUNT trials)
GIP pathway + GLP-1 pathway + Glucagon pathway → Retatrutide (triple agonist)
GIP + amylin → Potential future combinations for additive satiety and glucose control

Related Research

PMID	Title	Year	Study Type
39951489	GIP in Incretin Physiology: Role in Health and Disease	2025	Narrative Review
24843641	GIP and GLP-1: Incretin Actions Beyond the Pancreas	2013	Narrative Review

References

PMID-39951489 — Campbell & Drucker, GIP in incretin physiology, Endocr Rev 2025
PMID-24843641 — Campbell & Drucker, Incretin actions beyond pancreas, Cell Metab 2013

Educational Note: GIP is an endogenous hormone included in this vault for educational purposes. Understanding GIP physiology is essential for comprehending why dual (tirzepatide) and triple (retatrutide) incretin agonists produce superior outcomes compared to GLP-1-only agents.

#peptide #metabolic #endogenous #not-sold #incretin