GLP-1 (Native)

GLP-1 (Native)

โš ๏ธ Structural Separation Notice

The Ageless Pep Academy is a clinical education property independent from any commerce operation. Any references in this profile to Ageless Peps product SKUs, pricing, or the agelesspeps.com domain are for completeness and transparency; they are not endorsements and do not form part of the clinical education content. Clinicians are responsible for independent verification of any product sourcing decision. The Academy's Medical Director provides editorial oversight only and does not endorse commercial products.

Endogenous incretin hormone secreted by intestinal L-cells; potentiates glucose-dependent insulin secretion and suppresses appetite via GLP-1 receptor activation

Quick Facts

Property Value
Also Known As Glucagon-Like Peptide-1, GLP-1(7-36) amide, incretin, proglucagon fragment 78-107
Category Metabolic / Endocrine
Sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR (30 amino acids, GLP-1 7-36 amide active form)
Molecular Weight 3297.6 Da
Molecular Formula Cโ‚โ‚„โ‚‰Hโ‚‚โ‚‚โ‚…Nโ‚ƒโ‚‰Oโ‚„โ‚†
PubChem CID 56841596
Administration SubQ (research); endogenously secreted by intestinal L-cells and brainstem NTS neurons
Typical Dose Range 0.5-1.5 pmol/kg/min IV infusion (research studies); not used clinically as a drug due to ultrashort half-life
Half-Life <2 minutes (rapidly degraded by DPP-4 and NEP 24.11)
Storage Lyophilized: -20ยฐC; Reconstituted: 2-8ยฐC, use within 7 days
FDA Status Not approved as a drug; the native peptide's ultrashort half-life makes it impractical as a therapeutic. Modified analogs (semaglutide, liraglutide, dulaglutide, exenatide) are FDA-approved
WADA Status Not listed

Mechanism of Action

GLP-1(7-36) amide is the primary bioactive form of glucagon-like peptide-1, produced by post-translational processing of proglucagon in intestinal L-cells concentrated in the ileum and colon. It is secreted within minutes of nutrient ingestion (particularly glucose, fatty acids, and amino acids) as part of the "incretin effect" โ€” the observation that oral glucose elicits 50-70% greater insulin secretion than IV glucose at matched glycemic levels (PMID-29364588).

Upon release, GLP-1 activates the GLP-1 receptor (GLP-1R), a class B G protein-coupled receptor expressed on pancreatic beta-cells, alpha-cells, hypothalamic neurons, brainstem neurons, cardiomyocytes, and vascular endothelium. At the beta-cell, GLP-1R activation triggers cAMP/PKA and cAMP/Epac2 signaling cascades that potentiate glucose-dependent insulin secretion โ€” critically, this insulinotropic effect is glucose-dependent, meaning GLP-1 does not cause hypoglycemia when glucose levels are normal (PMID-17928588).

GLP-1 simultaneously suppresses glucagon secretion from pancreatic alpha-cells, delays gastric emptying via vagal afferent signaling, and activates hypothalamic appetite-suppressing circuits. Central GLP-1 receptors in the arcuate nucleus and paraventricular nucleus modulate POMC/CART (anorexigenic) and NPY/AgRP (orexigenic) neuronal activity, producing dose-dependent reductions in food intake of 15-30% in human infusion studies (PMID-24811133). Brainstem preproglucagon neurons in the nucleus tractus solitarius (NTS) also produce GLP-1, creating a parallel central signaling system that integrates peripheral satiety signals with appetite circuits (PMID-31002893).

The native peptide's clinical utility is fundamentally limited by its ultrashort half-life of approximately 2 minutes, as dipeptidyl peptidase-4 (DPP-4) cleaves the N-terminal His-Ala dipeptide to generate the inactive metabolite GLP-1(9-36) amide. This rapid degradation established the pharmacological rationale for two major drug classes: DPP-4 inhibitors (sitagliptin, etc.) that protect endogenous GLP-1, and DPP-4-resistant GLP-1 receptor agonists (semaglutide, liraglutide) that provide sustained receptor activation (PMID-17928588).

Key Research Areas

  1. Incretin Physiology & Glucose Homeostasis โ€” GLP-1 accounts for approximately 50-70% of the postprandial incretin effect. In type 2 diabetes, this incretin effect is markedly impaired, with GLP-1 retaining partial efficacy while GIP loses most of its insulinotropic potency. This differential preservation underpins the success of GLP-1-based therapies in T2D (PMID-29364588).

  2. Appetite Regulation & Weight Control โ€” GLP-1 reduces food intake through dual peripheral (vagal afferent gastric emptying delay) and central (hypothalamic POMC/CART activation) mechanisms. Human infusion studies demonstrate dose-dependent reductions in caloric intake and subjective hunger ratings (PMID-24811133).

  3. L-Cell Secretion Mechanisms โ€” L-cell GLP-1 secretion is regulated by luminal nutrient sensing via SGLT1 (glucose), GPR40/GPR120 (fatty acids), CaSR/GPRC6A (amino acids), and bitter taste receptors (polyphenols). Short-chain fatty acids from gut microbiota act on GPR41/GPR43 to modulate secretion (PMID-26637406, PMID-27287542).

  4. Neuroprotection & Cognitive Effects โ€” Central GLP-1R activation modulates mesolimbic dopamine signaling, exerts anti-apoptotic effects, reduces neuroinflammation via NF-kB suppression, and enhances synaptic plasticity. Preclinical evidence supports GLP-1R agonists as potential therapeutics for Alzheimer's and Parkinson's disease (PMID-31002893).

  5. Cardiovascular Protection โ€” GLP-1R activation produces direct effects on cardiomyocytes and endothelial cells, reduces atherosclerotic plaque inflammation, and attenuates NF-kB signaling in macrophages. These effects appear independent of weight loss and glycemic improvement (PMID-33320179).

  6. Translational Drug Development โ€” Understanding native GLP-1 biology yielded two blockbuster drug classes (GLP-1 RAs and DPP-4 inhibitors), dual agonists (tirzepatide), and triple agonists (retatrutide), now used by tens of millions of patients worldwide (PMID-29202475).

Evidence Level Summary

Evidence Type Count Notes
Human RCTs 0 Native GLP-1 studied via IV infusion protocols, not as a standalone therapeutic
Human observational 0 Extensive observational data exists for GLP-1 RAs (analogs), not the native peptide
Animal in vivo 0 Foundational rodent physiology studies integrated into reviews
In vitro 0 L-cell models, perfused intestine preparations integrated into reviews
Narrative reviews 6 Comprehensive reviews spanning physiology, secretion, signaling, and drug development

Clinical Applications

  • Weight Management โ€” GLP-1 is the endogenous mediator of meal-related satiety; understanding its physiology is essential for rational use of GLP-1 RAs and nutraceutical approaches to enhancing endogenous secretion
  • Type 2 Diabetes โ€” The impaired incretin effect in T2D is the pathophysiological basis for GLP-1-based therapies; native GLP-1 retains partial efficacy in T2D while GIP does not
  • Metabolic Syndrome โ€” GLP-1 signaling improves multiple metabolic parameters: insulin sensitivity, glucagon suppression, lipid metabolism, and inflammation
  • Neuroprotection โ€” Central GLP-1R activation provides anti-inflammatory and neurotrophic effects relevant to neurodegenerative disease
  • Cardiac Health โ€” GLP-1R-mediated cardiovascular protection via anti-inflammatory and direct cardioprotective mechanisms

Protocols Using This Peptide

Ageless Peps Products

Note: The GLP-1 Vial (WC ID 724, $130) is currently in DRAFT status on the Ageless Peps store and is not published. No product note has been created. When this product goes live, a Product note should be created.

No published Ageless Peps products contain native GLP-1 peptide.

BrainIQ Products Supporting GLP-1 Pathways

The Weight Loss FAST Melts are BrainIQ Health nutraceutical products sold on the Ageless Peps store. They do NOT contain GLP-1 peptide or any GLP-1 receptor agonist drug. Instead, they contain natural ingredients (African Mango, Berberine, Cissus quadrangularis, L-Carnitine, GBB, MCT Oil, NMN/NAD+, Allulose) that may support endogenous GLP-1 secretion pathways โ€” particularly berberine's AMPK activation and potential L-cell stimulation.

  • AP-GLP1-FastMelts-Manuka โ€” Weight Loss FAST Melts (Manuka Honey), $75
  • AP-GLP1-FastMelts-Chocolate โ€” Weight Loss FAST Melts (Chocolate), $75
  • AP-GLP1-FastMelts-Caramel โ€” Weight Loss FAST Melts (Caramel), $75

These are nutraceutical supplements, not pharmaceuticals. They should never be positioned as equivalent to prescription GLP-1 receptor agonists. The detailed ingredient science belongs in the BrainIQ vault.

Dosing Reference

Research Dosing Ranges (from literature)

Route Dose Range Frequency Duration Source
IV infusion 0.5-1.5 pmol/kg/min Continuous infusion (research) Acute (minutes-hours) PMID-17928588
SubQ Not clinically used N/A N/A Half-life too short (~2 min)

Cycling

Not applicable. Native GLP-1 is not used as an exogenous therapeutic due to its 2-minute half-life. For sustained GLP-1R activation, DPP-4-resistant analogs (semaglutide, liraglutide) or DPP-4 inhibitors are used instead. Endogenous GLP-1 secretion can be augmented through dietary strategies (protein-rich meals, polyphenols, prebiotic fiber) without cycling concerns.

Contraindications & Safety

  • Contraindications: Native GLP-1 has no specific contraindications as an endogenous hormone. For exogenous GLP-1 RAs: personal/family history of medullary thyroid carcinoma, MEN-2 syndrome, history of pancreatitis
  • Common side effects: IV GLP-1 infusion at pharmacological doses can cause nausea, vomiting, and delayed gastric emptying
  • Drug interactions: DPP-4 inhibitors increase endogenous GLP-1 levels; sulfonylureas combined with GLP-1 pathway enhancement increase hypoglycemia risk
  • Pregnancy/nursing: GLP-1 RAs are contraindicated in pregnancy (Category C); endogenous GLP-1 physiology is normal during pregnancy
  • Special populations: The incretin effect is impaired in elderly and T2D populations; GLP-1 secretion may be reduced in obesity and after bariatric surgery (though paradoxically increased post-RYGB)

Synergistic Combinations

  • GLP-2 โ€” Co-secreted from the same L-cells via proglucagon processing; GLP-1 handles metabolic/appetite effects while GLP-2 handles intestinal trophic effects. Understanding this co-secretion is key to the proglucagon biology framework
  • Semaglutide โ€” DPP-4-resistant GLP-1 RA that provides sustained activation of the same receptor native GLP-1 activates transiently
  • Tirzepatide โ€” Dual GIP/GLP-1 agonist that activates both incretin receptor systems, recapitulating and amplifying the full incretin effect
  • Retatrutide โ€” Triple GIP/GLP-1/glucagon agonist that adds glucagon receptor-mediated hepatic lipid oxidation to the incretin backbone

Related Research

PMID Title Year Study Type
PMID-17928588 The Physiology of Glucagon-Like Peptide 1 2007 Narrative Review
PMID-24811133 Effects of GLP-1 on Appetite and Weight 2014 Narrative Review
PMID-26637406 Molecular Mechanisms of Glucose-Stimulated GLP-1 Secretion 2016 Narrative Review
PMID-27287542 The Incretin Hormone GLP-1 and Mechanisms Underlying Its Secretion 2016 Narrative Review
PMID-29364588 Incretin Hormones: Their Role in Health and Disease 2018 Narrative Review
PMID-31002893 GLP-1: Molecular Mechanisms and Outcomes of a Complex Signaling System 2019 Narrative Review

References

  • PMID-17928588: Holst JJ. The Physiology of Glucagon-Like Peptide 1. Physiol Rev. 2007;87(4):1409-1439.
  • PMID-24811133: Shah M, Vella A. Effects of GLP-1 on Appetite and Weight. Rev Endocr Metab Disord. 2014;15(3):181-187.
  • PMID-26637406: Kuhre RE et al. Molecular Mechanisms of Glucose-Stimulated GLP-1 Secretion. Clin Sci. 2016;130(2):79-91.
  • PMID-27287542: Tian L, Jin T. The Incretin Hormone GLP-1 and Mechanisms Underlying Its Secretion. J Diabetes. 2016;8(6):753-765.
  • PMID-29202475: Drucker DJ, Habener JF, Holst JJ. Discovery, Characterization, and Clinical Development of the Glucagon-Like Peptides. J Clin Invest. 2017;127(12):4217-4227.
  • PMID-29364588: Nauck MA, Meier JJ. Incretin Hormones: Their Role in Health and Disease. Diabetes Obes Metab. 2018;20(Suppl 1):5-21.
  • PMID-31002893: Smith NK et al. GLP-1: Molecular Mechanisms and Outcomes of a Complex Signaling System. Neurochem Int. 2019;128:94-105.
  • PMID-33320179: McLean BA et al. Revisiting the Complexity of GLP-1 Action. Endocrine Reviews. 2021;42(2):101-132.

Related

#peptide #metabolic #subq